PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_6066.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 160aa    MW: 18494.3 Da    PI: 9.5219
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_6066.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.5e-5291361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGf FhP+d elv +yLkkk+ g+k+e  ++i+evdiyk+ePwdLp+  +v +++++w+fF+ rd+ky++g r+nrat +gyWk+tgkd+++++ +
  MLOC_6066.2   9 LPPGFGFHPKDTELVAHYLKKKILGQKIEY-DIIPEVDIYKHEPWDLPAkcNVPTQDNKWHFFAARDRKYPNGARSNRATVAGYWKSTGKDRAIKV-D 104
                  79****************************.99***************5346667999**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLvf++gr p+g++t+W+mhey +
  MLOC_6066.2 105 KRTIGTKKTLVFHEGRPPTGKRTEWIMHEYYI 136
                  99****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-564145IPR003441NAC domain
PROSITE profilePS5100550.7269160IPR003441NAC domain
PfamPF023656.0E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
METLRAMALP PGFGFHPKDT ELVAHYLKKK ILGQKIEYDI IPEVDIYKHE PWDLPAKCNV  60
PTQDNKWHFF AARDRKYPNG ARSNRATVAG YWKSTGKDRA IKVDKRTIGT KKTLVFHEGR  120
PPTGKRTEWI MHEYYIDENE CQACPDMKVG IVPTIEVSKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-46713613140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2521800.0AK252180.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf146l14, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566632.11e-104PREDICTED: NAC domain-containing protein 74-like
SwissprotQ7GCL71e-101NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLM0XJP01e-118M0XJP0_HORVD; Uncharacterized protein
STRINGMLOC_6066.11e-108(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.13e-63NAC domain containing protein 57